A practical reference on somatotroph: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2026-03-16. Anything still debated is marked as such rather than presented as settled.
CJC-1295 belongs to a class of synthetic peptides modeled on growth hormone releasing hormone, a forty-four amino acid signal produced by the hypothalamus. The compound is built from the first twenty-nine residues of the natural sequence, with four substitutions introduced at positions 2, 8, 15 and 27. These changes were designed to slow enzymatic breakdown while preserving receptor activation. The result is a peptide that is shorter than native GHRH and considerably more resistant to ordinary clearance pathways in circulation.
Two related forms appear under the CJC-1295 name. The simpler analogue, commonly written as modified GRF(1-29), carries the four substitutions but no additional conjugation. The second form attaches a maleimidopropionic acid linker to a lysine residue, a modification frequently called the drug affinity complex. That linker reacts with the free thiol on serum albumin to form a covalent bond. Because albumin has a long residence time in blood, the conjugated peptide stays in circulation far longer than the unconjugated analogue.
Receptor level activity follows the canonical GHRH pathway. The peptide binds the GHRH receptor, a class B G protein coupled receptor on somatotroph cells of the anterior pituitary. Binding raises intracellular cyclic AMP, which promotes calcium entry and the release of growth hormone into the bloodstream. Because the molecule acts at the same receptor as the endogenous hormone, its effect is superimposed on the natural pulsatile rhythm rather than replacing it. Whether sustained receptor occupation leads to desensitization is not fully settled.
CJC-1295 is a synthetic peptide analog of growth hormone-releasing hormone, constructed on the 29-amino-acid fragment designated GRF(1-29). The name began as an internal development code during the 1990s and later spread through research supply catalogs and discussion forums. The molecule does not occur in nature; its sequence is engineered rather than isolated from tissue. Two related compounds are sold under this single label, and they differ by one appended chemical group that strongly influences how long the peptide remains in circulation.
The dividing feature between the two forms is a maleimide-based drug affinity complex, abbreviated DAC. In the DAC-bearing version, a linker attaches the peptide to serum albumin after administration, and that association slows removal from plasma. The version lacking DAC appears in catalogs as MOD GRF(1-29) or tetrasubstituted GRF(1-29). Because informal writing treats both as one item, comparisons drawn from such sources routinely blend measurements taken from two molecules with substantially different behavior.
| Property | Value | Notes |
|---|---|---|
| Peptide class | Synthetic GHRH analogue | Built on a 29 residue sequence |
| Primary target | GHRH receptor (GHRHR) | Class B G protein coupled receptor |
| Unconjugated half life | Minutes | Limited by protease degradation |
| Key modification | Four residue substitutions | Positions 2, 8, 15 and 27 |
| Common synonym | Modified GRF(1-29) | Usually denotes the form without DAC |
Lyophilised powder is the usual supplied form. The material is hygroscopic, so vials are typically equilibrated to room temperature before opening in order to prevent condensation on the contents. Long-term storage is generally described at minus twenty degrees Celsius or colder, protected from light and moisture. Repeated freeze-thaw cycles are avoided because they promote aggregation and loss of soluble material. A reconstituted solution is considerably less stable than the dry powder and is normally kept refrigerated for short periods only.
Identity and purity are assessed mainly by reversed-phase high-performance liquid chromatography combined with mass spectrometry. The chromatographic separation resolves the target peptide from truncation products and from species carrying oxidised residues, while mass measurement confirms the expected molecular mass. Because the two common variants differ by roughly 280 daltons, a mass determination distinguishes them unambiguously. Purity is often quoted as a percentage of total peak area, although that figure depends on the detection wavelength and the integration method applied.
CJC-1295 is a synthetic peptide designed to mimic growth hormone-releasing hormone (GHRH), the endogenous signal that prompts the pituitary gland to release growth hormone. The compound is a modified fragment of the natural hormone, spanning the first twenty-nine amino acids of GHRH with several substitutions that slow enzymatic breakdown. Two variants circulate in research settings: one carrying a drug affinity complex (DAC) and one without it. The DAC-free form is frequently labelled Mod GRF(1-29) in catalogs and discussion forums.
The peptide binds GHRH receptors on somatotroph cells within the anterior pituitary, triggering a signalling cascade that increases growth hormone secretion. Its improved resistance to dipeptidyl peptidase IV degradation distinguishes it from the parent hormone. In the DAC-bearing version, a maleimide group reacts with a cysteine residue on serum albumin, forming a covalent bond that keeps the peptide in circulation far longer. That albumin attachment is the central design feature separating the two research variants.
In March 2008, AFRL's Human Effectiveness Directorate located at Wright-Patterson AFB was merged with the Air Force School of Aerospace Medicine and the Human Performance Integration Directorate from the 311th Human Systems Wing both located at Brooks City-Base, Texas to form the 711th Human Performance Wing. In its vision statement, the wing includes the goals of improving aerospace medicine, science and technology, and human systems integration. The current Commander of the 711th is Brig. Gen. Timothy Jex. One practical application of its work is ensuring and advancing the safety of ejection systems for pilots. With the increasing number of females in the Air Force ranks, anthropometry is of greater import now than ever, and 711th's WB4 'whole-body scanner' enables swift and accurate acquisition of anthropometric data which may be used to design pilot equipment with a better fit for comfort and safety.
=== Physical and atomic === Bohrium is expected to be a solid under normal conditions and assume a hexagonal close-packed crystal structure (c/a = 1.62), similar to its lighter congener rhenium. Early predictions by Fricke estimated its density at 37.1 g/cm3, but newer calculations predict a somewhat lower value of 26–27 g/cm3. The atomic radius of bohrium is expected to be around 128 pm. Due to the relativistic stabilization of the 7s orbital and destabilization of the 6d orbital, the Bh+ ion is predicted to have an electron configuration of [Rn] 5f14 6d4 7s2, giving up a 6d electron instead of a 7s electron, which is the opposite of the behavior of its lighter homologues manganese and technetium. Rhenium, on the other hand, follows its heavier congener bohrium in giving up a 5d electron before a 6s electron, as relativistic effects have become significant by the sixth period, where they cause among other things the yellow color of gold and the low melting point of mercury. The Bh2+ ion is expected to have an electron configuration of [Rn] 5f14 6d3 7s2; in contrast, the Re2+ ion is expected to have a [Xe] 4f14 5d5 configuration, this time analogous to manganese and technetium. The ionic radius of hexacoordinate heptavalent bohrium is expected to be 58 pm (heptavalent manganese, technetium, and rhenium having values of 46, 57, and 53 pm respectively). Pentavalent bohrium should have a larger ionic radius of 83 pm.
=== Approaches === Psychiatric illnesses can be conceptualised in several different ways. The biomedical approach examines signs and symptoms and compares them with diagnostic criteria. Mental illness can be assessed, conversely, through a narrative which tries to incorporate symptoms into a meaningful life history and to frame them as responses to external conditions. For example, the Power Threat Meaning Framework (PTMF) is a conceptual approach to understanding mental distress that serves as an alternative to traditional psychiatric diagnostic systems. Rather than viewing distress primarily as a symptom of an underlying mental disorder, the framework emphasizes the role of adversity, trauma, social inequalities, relationships, and cultural contexts in shaping people's experiences, and proposes that many forms of distress can be understood as meaningful responses to difficult circumstances. Both approaches are considered important in the field of psychiatry, but have not sufficiently reconciled to settle controversy over either the selection of a psychiatric paradigm or the specification of psychopathology. The biopsychosocial model is used to explain the multifactorial origins of clinical impairment, recognizing that biological, psychological, and social factors all play a role in health and disease. Once a medical professional diagnoses a patient there are numerous ways that they could choose to treat the patient. Often psychiatrists will develop a treatment strategy that incorporates different facets of different approaches into one.
Sources: en.wikipedia.org
=== Reductive elimination step === In order for R1-R2 to reductively eliminate, these groups must occupy mutually cis coordination sites. Any trans-adducts must therefore isomerize to the cis intermediate or the coupling will be frustrated. A variety of mechanisms exist for reductive elimination and these are usually considered to be concerted. First, the 16-electron tetravalent intermediate from the transmetalation step can undergo unassisted reductive elimination from a square planar complex. This reaction occurs in two steps: first, the reductive elimination is followed by coordination of the newly formed sigma bond between R1 and R2 to the metal, with ultimate dissociation yielding the coupled product.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Profilin was first described by Lars Carlsson in the lab of Uno Lindberg and co-workers in the early 1970s as the first actin monomer binding protein. It followed the realization that not only muscle, but also non-muscle cells, contained high concentrations of actin, albeit in part in an unpolymerized form. Profilin was then believed to sequester actin monomers (keep them in a pro-filamentous form), and release them upon a signal to make them accessible for fast actin polymer growth.
Sources: en.wikipedia.org
=== The mathematics of substitution models === Stationary, neutral, independent, finite sites models (assuming a constant rate of evolution) have two parameters, π, an equilibrium vector of base (or character) frequencies and a rate matrix, Q, which describes the rate at which bases of one type change into bases of another type; element
=== Simmering hostilities === Although the Vaal uprising marked the beginning of an open and sustained revolt, it was preceded by an "underground war" or "series of localised confrontations", for example clashes in Pietermaritzburg in 1982; in Durban and Mdantsane in 1983; and in Crossroads, Atteridgeville, Cradock, Tumahole, and the East Rand earlier in 1984. Over the same period, in Soweto and some other areas, there was a demonstrable upswing in a longstanding habit of persecution of black local councillors. The boycott of the 1984 election, held in the last week of August, was accompanied by large-scale protests, resulting in a large number of arrests. Some of the candidates for the Tricameral Parliament were also targeted in petrol bomb attacks.
The main gas supply for surface-supplied diving can be from high pressure bulk storage cylinders. When the storage cylinders are relatively portable this is known as a scuba replacement system in the commercial diving industry. The application is versatile and can ensure high quality breathing gas in places where atmospheric air is too contaminated to use through a normal low pressure compressor filter system, and is easily adaptable to a mixed gas supply and oxygen decompression provided that the breathing apparatus and gas supply system are compatible with the mixtures to be used. Scuba replacement is often used from smaller diving support vessels, for emergency work, and for hazmat diving. Mixed breathing gases are provided from high pressure bulk storage systems for saturation diving, but these are less portable, and generally involve manifolded racks of cylinders of approximately 50 litres water capacity arranged as quads and even larger racks of high pressure tubes. If gas reclaim systems are used, the reclaimed gas is scrubbed of carbon dioxide, filtered of other contaminants, and recompressed into high pressure cylinders for interim storage, ans is generally blended with oxygen or helium to make up the required mix for the next dive before re-use.
Sources: en.wikipedia.org
The names are often used interchangeably in casual writing, but they are not strictly identical. Modified GRF(1-29) refers to the unconjugated analogue carrying only the four substitutions. The version sold as CJC-1295 with DAC includes the albumin binding linker and clears much more slowly.
DAC stands for drug affinity complex, a term describing the maleimidopropionic acid linker. This group forms a covalent bond with the cysteine residue on serum albumin after administration. The resulting adduct is what extends the circulating half life from minutes to days.
No. It is entirely synthetic and does not correspond to any known endogenous peptide. The design starts from human growth hormone releasing hormone and introduces deliberate substitutions. Any biological effect comes from mimicking the natural hormone at its receptor.
No. It is a laboratory-synthesized analog built on a fragment of the natural hormone. The natural peptide is shorter-lived and lacks the stabilizing substitutions found in the synthetic version.