Albumin binding comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Updated 2026-05-24. Numbers and descriptions here follow the published literature rather than marketing material.
Identity and purity are assessed mainly by reversed-phase high-performance liquid chromatography combined with mass spectrometry. The chromatographic separation resolves the target peptide from truncation products and from species carrying oxidised residues, while mass measurement confirms the expected molecular mass. Because the two common variants differ by roughly 280 daltons, a mass determination distinguishes them unambiguously. Purity is often quoted as a percentage of total peak area, although that figure depends on the detection wavelength and the integration method applied.
Reported half-lives differ widely between the two variants and between species. Values for the albumin-binding form are usually expressed in days, while the unconjugated form is measured in minutes to a few hours. Sampling schedules, assay sensitivity, and route of administration all influence the numbers, which limits direct comparison across studies. Whether sustained receptor occupancy produces different downstream effects from pulsatile stimulation remains an open question in the published work. Claims about relative potency should therefore be read alongside the specific study design that produced them.
Lyophilised powder is the usual supplied form. The material is hygroscopic, so vials are typically equilibrated to room temperature before opening in order to prevent condensation on the contents. Long-term storage is generally described at minus twenty degrees Celsius or colder, protected from light and moisture. Repeated freeze-thaw cycles are avoided because they promote aggregation and loss of soluble material. A reconstituted solution is considerably less stable than the dry powder and is normally kept refrigerated for short periods only.
The peptide backbone includes a D-alanine at position two, which resists cleavage by dipeptidyl peptidase IV, and several other substitutions that reduce degradation. Its molecular weight is roughly 3.4 kDa without the linker and about 3.6 kDa with it. The molecule is water soluble and is normally supplied as a lyophilized powder. Precise sequence and mass values depend on which variant is described, so technical documents usually state the exact form being referenced.
CJC-1295 is a synthetic peptide designed as a long-acting analogue of growth hormone-releasing hormone (GHRH). Its structure derives from the first 29 amino acids of native GHRH, a fragment often called GRF(1-29). Four substitutions were introduced to slow enzymatic breakdown and extend activity relative to the natural sequence. The compound was developed by ConjuChem as part of a broader effort to improve the pharmacokinetic profile of peptide hormones. It is studied in laboratory and clinical research settings rather than appearing as a naturally occurring substance.
Two related forms circulate in technical discussion under the same family name. The original version carries a drug affinity complex (DAC) that binds covalently to serum albumin after administration, and this linkage substantially extends circulation time. A second form, frequently written as modified GRF(1-29) or CJC-1295 without DAC, lacks that linker and clears much faster. The naming is a frequent source of confusion because the shorthand CJC-1295 can refer to either form depending on the source. Reports sometimes fail to specify which variant was studied.
| Property | Value | Notes |
|---|---|---|
| Appearance as powder | White to off-white solid | Minor batch-to-batch variation is normal |
| Solubility class | Soluble in water and aqueous buffers | Dissolution can be slowed by aggregates |
| Typical storage temperature | Minus 20 degrees Celsius or below | Protected from light and moisture |
| Storage after reconstitution | 2 to 8 degrees Celsius, short term | Longer holding requires freezing |
| Common analytical method | Reversed-phase HPLC with mass spectrometry | Used for purity and identity confirmation |
CJC-1295 belongs to a family of synthetic peptides modeled on growth hormone-releasing hormone, the hypothalamic signal that prompts the pituitary to release growth hormone. The compound is built from the first twenty-nine amino acids of the natural human sequence, a fragment that retains full receptor binding capacity. Native growth hormone-releasing hormone is degraded quickly in circulation, so the fragment alone has limited practical value. Early work therefore focused on chemical modifications that preserve receptor binding while slowing enzymatic breakdown. The result is a molecule described in the literature as a long-acting analog of the natural hormone.
Binding of the peptide to the growth hormone-releasing hormone receptor on pituitary somatotrophs triggers a G protein coupled cascade that raises cyclic AMP and opens calcium channels. The result is greater secretion of growth hormone into the bloodstream. Because the peptide acts at the same receptor as the natural hypothalamic hormone, its effect is amplified pulse size rather than an entirely separate release pathway. Receptor binding alone does not determine the response, since somatostatin tone and other inputs modulate the final output.
The albumin-binding version stays in circulation for days, because covalent attachment to serum albumin shields the peptide from rapid filtration and degradation. Reported half-lives for this form fall in the range of several days. The version without the linker is cleared in minutes, with estimates often near thirty minutes in animal work. These figures come from small studies and vary with assay method, species, and route, so they are best read as approximate rather than fixed constants.
Clearance profiles diverge sharply between the two versions. The albumin-binding molecule stays in plasma for several days, whereas the unmodified analog is largely gone within about half an hour in reported work. Cleavage by dipeptidyl peptidase IV is a major contributor to the short life of the unmodified sequence. These gaps mean the two versions cannot be substituted for each other in study design or in reading results side by side.
Reports on this compound commonly follow serum growth hormone and insulin-like growth factor 1 across defined time windows. Protocols differ in sampling frequency, assay platform, and participant characteristics, which makes direct comparison between publications difficult. Some work focuses on pulsatile release patterns instead of average concentrations. Whether repeated exposure alters endogenous hormone rhythms over long periods remains an open question, and the formal literature is thinner than the volume of informal commentary implies.
Once in circulation, the peptide binds the growth hormone-releasing hormone receptor displayed on pituitary somatotroph cells. Receptor activation couples to Gs proteins, elevates intracellular cyclic AMP, and drives protein kinase A signaling inside the cell. That cascade increases discharge of growth hormone into the bloodstream. The analog therefore operates through a receptor pathway that already exists for the body's own releasing hormone, rather than through an engineered artificial target.
Sattvic diet (also known as yogic diet), a plant-based diet which may also include dairy and honey, but excludes eggs, red lentils, durian, mushrooms, alliums, blue cheeses, fermented foods or sauces, and alcoholic drinks. Coffee, black or green tea, chocolate, nutmeg, and any other type of stimulant (including excessively pungent spices) are sometimes excluded, as well. Jain vegetarianism is a strict form of lacto-vegetarianism. It excludes meat, eggs, and honey, but it also excludes root vegetables and bulbs, such as potatoes, onions, and garlic. This is because ancient Jain botanical classifications identified these underground plant parts as hosts for dense colonies of microscopic life forms, known as nigoda. Because of this, the Jain diet is one of the earliest recorded food systems designed around microbiological conservation, extending the rule of nonviolence to micro-ecosystems. Beyond the exclusion of root vegetables, the Jain diet further restricts several specific plant categories based on early biological conservation principles:
Vitamin B12 deficiency can potentially cause severe and irreversible damage, especially to the brain and nervous system. At levels only slightly below normal, deficiency can result in fatigue, headaches, feeling faint, rapid breathing, pale skin, numbness or tingling, poor appetite, heartburn, poor balance, difficulty walking, poor reflexes, blurred vision, memory problems, depression, irritability, inattention, cognitive decline, dementia, and even psychosis. Among other problems, weakened immunity, reduced fertility and interruption of blood circulation in women may occur. It has also been linked to optic nerve atrophy and neuritis. The main type of vitamin B12 deficiency anemia is pernicious anemia, characterized by a triad of symptoms:
== Health concerns == Energy drinks have been associated with health risks, such as masking the effects of intoxication when mixed and consumed with alcohol, and excessive or repeated consumption can lead to cardiac and psychiatric conditions. However, the European Food Safety Authority (EFSA) concluded that an adequate consumption of Monster and other popular energy drinks is safe and that the amount of caffeine in standard Monster cans is unlikely to interact adversely with other typical constituents of energy drinks or with alcohol. Energy drinks have the effects that caffeine and sugar give, but there is no distinct evidence that the wide variety of other ingredients has any effect. In December 2011, 14-year-old Anais Fournier died of "cardiac arrhythmia due to caffeine toxicity" after drinking two 24 US fluid ounces (710 mL) cans of Monster Energy drink containing 240 mg of caffeine per can. Fournier had a pre-existing heart condition, as well as Ehlers–Danlos syndrome. In October 2012, her parents sued the company. Monster Energy has insisted that its energy drink played no role in Fournier's death. A request under the U.S. Freedom of Information Act revealed that from 2003 to 2012 the Food and Drug Administration (FDA) had received reports of five deaths occurring after drinking Monster Energy. The reports did not prove a causal link between the drink and any health problems. In May 2015, the Food Safety and Standards Authority of India (FSSAI) banned the sale of Monster and other energy drinks that contained both caffeine and ginseng.
Friedrich Engelhorn Heinrich von Brunck Carl Bosch Carl Wurster Bernhard Timm Matthias Seefelder Jürgen Strube 1990-2003 Jürgen Hambrecht 2003-2011 Kurt Bock 2011-2018 Martin Brudermüller 2018-2024 Markus Kamieth 2024–present
== Pathophysiology == Since envenomation is completely voluntary, all venomous snakes are capable of biting without injecting venom into a person. Snakes may deliver such a "dry bite" rather than waste their venom on a creature too large for them to eat, a behaviour called venom metering. However, the percentage of dry bites varies among species: 80 percent of bites inflicted by sea snakes, which are normally timid, do not result in envenomation, whereas for pit viper bites the number is closer to 25 percent. Furthermore, some snake genera, such as rattlesnakes, can internally regulate the amount of venom they inject. There is a wide variance in the composition of venoms from one species of venomous snake to another. Some venoms may have their greatest effect on a victim's respiration or circulatory system. Others may damage or destroy tissues. This variance has imparted to the venom of each species a distinct chemistry. Sometimes antivenins have to be developed for individual species. For this reason, standard therapeutic measures will not work in all cases. Some dry bites may also be the result of imprecise timing on the snake's part, as venom may be prematurely released before the fangs have penetrated the person. Even without venom, some snakes, particularly large constrictors such as those belonging to the Boidae and Pythonidae families, can deliver damaging bites; large specimens often cause severe lacerations, or the snake itself pulls away, causing the flesh to be torn by the needle-sharp recurved teeth embedded in the person.
Sources: en.wikipedia.org
The proposed conformational transition is thought to allow the newly-generated coiled region (incorporating residues 'RRYLENGKETLQR' which have also been found to be naturally bound to HLA-B27 as a 9-mer peptide) to bind to either the peptide-binding cleft of the same polypeptide chain (in an act of self-display) or to the cleft of another polypeptide chain (in an act of cross-display). Cross-display is proposed to lead to the formation of large, soluble, high molecular weight (HMW), degradation-resistant, long-surviving aggregates of the HLA-B27 heavy chain. Together with any homodimers formed either by cross-display or by a disulfide-linked homodimerization mechanism, it is proposed that such HMW aggregates survive on the cell surface without undergoing rapid degradation, and stimulate an immune response. Three previously noted features of HLA-B27, which distinguish it from other heavy chains, underlie the hypothesis: (1) HLA-B27 has been found to be bound to peptides longer than 9-mers, suggesting that the cleft can accommodate a longer polypeptide chain; (2) HLA-B27 has been found to itself contain a sequence that has also been actually discovered to be bound to HLA-B27, as an independent peptide; and (3) HLA-B27 heavy chains lacking β2 microglobulin have been seen on cell surfaces.
The morphological structure of the human breast is identical in males and females until puberty. For pubescent girls in thelarche (the breast-development stage), the female sex hormones (principally estrogens) in conjunction with growth hormone promote the sprouting, growth, and development of the breasts. During this time, the mammary glands grow in size and volume and begin resting on the chest. These development stages of secondary sex characteristics (breasts, pubic hair, etc.) are illustrated in the five-stage Tanner scale. During thelarche, the developing breasts are sometimes of unequal size, and usually the left breast is slightly larger. This condition of asymmetry is transitory and statistically normal in female physical and sexual development. Medical conditions can cause overdevelopment (e.g., juvenile breast hypertrophy, macromastia) or underdevelopment (e.g., tuberous breast deformity, micromastia) in girls and women. Approximately two years after the onset of puberty (a girl's first menstrual cycle), estrogen and growth hormone stimulate the development and growth of the glandular fat and suspensory tissues that compose the breast. This continues for approximately four years until the final shape of the breast (size, volume, density) is established at about the age of 21. Mammoplasia (breast enlargement) in girls begins at puberty, unlike all other primates, in which breasts enlarge only during lactation.
== History == Creatine was first identified in 1832 when Michel Eugène Chevreul isolated the precipitate from the basified water-extract of skeletal muscle. He later named the crystallized precipitate after the Greek word for meat, κρέας (kreas). In 1928, creatine was shown to exist in equilibrium with creatinine. Studies in the 1920s showed that consumption of large amounts of creatine did not result in its excretion. This result pointed to the ability of the body to store creatine, which in turn suggested its use as a dietary supplement. In 1912, Harvard University researchers Otto Folin and Willey Glover Denis found evidence that ingesting creatine can dramatically boost the creatine content of the muscle. The discovery of phosphocreatine was reported in 1927. In the 1960s, the enzyme creatine kinase was shown to phosphorylate ADP using phosphocreatine to generate ATP and thus buffering the ATP/ADP ratio. While creatine's influence on physical performance has been well documented since the early twentieth century, it came into public view following the 1992 Olympics in Barcelona. An 7 August 1992 article in The Times reported that Linford Christie, the gold medal winner at 100 metres, had used creatine before the Olympics. An article in Bodybuilding Monthly named Sally Gunnell, who was the gold medalist in the 400-metre hurdles, as another creatine user. In addition, The Times also noted that 110 metre hurdler Colin Jackson began taking creatine before the Olympics.
== Research and partnerships == Mondobiotech investigated whether information already published about naturally occurring human substances could suggest new uses in rare diseases. A 2010 case study by researchers at the University of St. Gallen described its use of scientific literature, external researchers and laboratories, and licensing partners instead of maintaining a conventional in-house laboratory operation. Financial news reporting also described the company's approach as searching medical databases for drug candidates and licensing rights to other companies. In 2002, Mondobiotech and InterMune agreed to collaborate on interferon gamma-1b research for pulmonary diseases, including asthma; the arrangement also covered specified patent rights relating to idiopathic pulmonary fibrosis. In 2006, Biogen Idec licensed rights to develop aviptadil for pulmonary arterial hypertension. The agreement included a US$7.5 million upfront payment and up to US$30 million in possible development and commercialization milestones; the milestone amount was conditional, not a payment already received. Biogen stated in a later regulatory filing that it ended its participation in the aviptadil development program in December 2009. In February 2010, Mondobiotech entered a partnership with Lung Rx, a subsidiary of United Therapeutics, for further development of aviptadil. The company also agreed in 2009 to have Bachem develop and manufacture peptides for its research programs.
Sources: en.wikipedia.org
The influence of the art of Gandhara in some of the paintings at the Kizil Caves, dated to circa 500 CE, is considered as a consequence of the political unification of the area between Bactria and Kucha under the Hephthalites. The paintings of the Caves of the Painters have been carbon dated to 478–536 CE. Albert Grünwedel in 1912 considered that the murals of the "Cave of the Statues" had been "made by the same artists as those of the Cave of the Painters", and that they were in "pure Gandhara style". Also, a self-portraited painter in the Caves of the Statues, holding a cup of paint, has clothes which "exactly match" those of the painters in the "Cave of the Painters" (caftan, boots...). The clothing style of the painters at Kizil has often been described as Sasanian, but is now rather considered as Hephthalite due to the similarities with the figures in Bamiyan, Dilberjin Tepe or Balalyk Tepe. Grünwedel attributed both caves to the same "Stage I" period (500–600 CE). The main cella contains 18 scenes of the Buddha preaching. The niche must have contained a monumental statue of the Buddha, and paintings related to the Indrasala Cave narrative. The ceiling is prismatic, reproducing a type of architecture known from Bamiyan. The right corridor contained murals related to the War for the Relics and the Sharing of the relics of the Buddha, one of them showing armoured warriors on horses. The murals of the back corridor were almost entirely gone by 1912. Only a few traces remained, suggesting scenes of the Parinirvana.
Biopolymers are natural polymers produced by the cells of living organisms. Like other polymers, biopolymers consist of monomeric units that are covalently bonded in chains to form larger molecules. There are three main classes of biopolymers, classified according to the monomers used and the structure of the biopolymer formed: polynucleotides, polypeptides, and polysaccharides. The polynucleotides, RNA and DNA, are long polymers of nucleotides. Polypeptides include proteins and shorter polymers of amino acids; some major examples include collagen, actin, and fibrin. Polysaccharides are linear or branched chains of sugar carbohydrates; examples include starch, cellulose, and alginate. Other examples of biopolymers include natural rubbers (polymers of isoprene), suberin and lignin (complex polyphenolic polymers), cutin and cutan (complex polymers of long-chain fatty acids), melanin, and polyhydroxyalkanoates (PHAs).
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Sources: en.wikipedia.org
Chromatography reports how much material elutes as a single peak but does not confirm what that material is. Mass spectrometry supplies the molecular mass, which is characteristic of a given sequence and its modifications. Together the two methods support both a purity figure and an identity claim.
Hydrolysis, oxidation of susceptible residues, and aggregation all contribute, and their rates depend on pH, temperature, and concentration. Dissolved oxygen and trace metal ions accelerate oxidation. Keeping solutions cold, dilute, and free of unnecessary handling reduces these pathways.
Not always, because the value depends on the detection wavelength, the gradient, and how peak areas are integrated. A figure of ninety-eight percent from one laboratory may not mean the same as the same number from another. Comparing full chromatograms and mass spectra is more informative than comparing a single number.
No. It is a synthetic analogue modeled on the first 29 residues of human GHRH. The substitutions and any linker are laboratory modifications rather than features of the endogenous peptide.