Everything below concerns DAC. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2025-07-22. Numbers and descriptions here follow the published literature rather than marketing material.
Lyophilized material is generally stable for extended periods when held at minus twenty degrees Celsius or below and protected from moisture and light. In solution the peptide is more labile; bond hydrolysis, aggregation and oxidation of susceptible residues all proceed faster at ambient temperature. Repeated freeze and thaw cycles should be avoided because they promote clumping and loss of soluble material. The conjugated variant adds a further consideration, since the maleimide group can hydrolyze in aqueous buffer and lose its ability to react with albumin.
Laboratory handling centers on minimizing exposure to water, heat and oxygen before use. Working solutions are typically prepared in sterile water or a mild buffer, and any residual particulate matter is removed by filtration. When the powder dissolves slowly, a small proportion of acetonitrile or dilute acetic acid is sometimes added as a co-solvent. Containers are kept sealed and desiccated between uses. Records of lot number, reconstitution date and storage conditions support later comparison of results across experiments.
Identity and purity are established with reversed phase high performance liquid chromatography coupled to mass spectrometry. The chromatographic step separates the target peptide from truncated sequences and deletion products, while the mass measurement confirms the expected molecular weight to within a fraction of a dalton. Because the two common variants differ by the presence of the linker, mass alone can distinguish them in the unconjugated state. Amino acid analysis and peptide mapping are used when sequence level confirmation is required.
Verification matters because research peptides vary widely in quality. A certificate of analysis is only as reliable as the method behind it, and a single chromatographic trace reveals little about counter-ions, residual solvents, or water content. Independent laboratories commonly pair mass confirmation with chromatographic purity and, where relevant, quantify water along with acetate or trifluoroacetate content. Reported purity figures are not standardized across suppliers, so a stated value such as ninety-eight percent is not directly comparable unless the analytical method, column, and detection wavelength accompany it.
Characterization of this peptide relies on a small set of routine techniques. Reversed-phase high-performance liquid chromatography separates the target from truncated or oxidized by-products and yields a purity estimate when paired with ultraviolet detection near 214 nanometers. Mass spectrometry, either electrospray coupled to liquid chromatography or matrix-assisted laser desorption, confirms that the observed mass matches the value calculated for the expected sequence. Amino acid analysis, and enzymatic digestion followed by fragment mapping, are used when the sequence itself rather than the mass requires verification.
Stability depends heavily on physical state. A lyophilized powder kept dry, desiccated, and shielded from light typically holds its integrity for months to years at minus twenty degrees Celsius, and longer at minus eighty. Once dissolved, the peptide becomes far more vulnerable, since peptide bond hydrolysis, oxidation of susceptible residues, and aggregation all proceed faster in solution. Buffers near neutral pH are generally gentler than strongly acidic or alkaline conditions. Repeated freeze-thaw cycles and exposure to air-liquid interfaces during vigorous mixing cause losses that are easy to overlook.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off white powder | Typical lyophilized form |
| Water solubility | Soluble | May need a small organic co-solvent |
| Purity assessment | Chromatographic peak area | Most certificates report a percentage figure |
| Storage temperature | Minus 20 C or lower | Dry, dark, sealed container |
| Identity check | Electrospray mass spectrometry | Compared against theoretical mass |
Research material is normally supplied as a freeze-dried powder in sealed vials. In that state the peptide is comparatively robust, but prolonged exposure to warmth, moisture, or light accelerates degradation. Storage at minus twenty degrees Celsius or lower, with desiccant and protection from light, is the commonly described practice. Vials should be allowed to reach room temperature before opening to limit condensation on the powder. Moisture uptake during handling is a recognized source of variability in later measurements.
Reconstitution is typically performed with sterile water or bacteriostatic water, added slowly against the vial wall. The resulting solution should be clear and colorless; cloudiness or visible particles suggest a problem with the material or the diluent. Once in solution, the peptide is less stable than the dry powder. Refrigerated storage at two to eight degrees Celsius is common for short-term holding, while freezing aliquots is described for longer periods.
The dividing feature between the two forms is a maleimide-based drug affinity complex, abbreviated DAC. In the DAC-bearing version, a linker attaches the peptide to serum albumin after administration, and that association slows removal from plasma. The version lacking DAC appears in catalogs as MOD GRF(1-29) or tetrasubstituted GRF(1-29). Because informal writing treats both as one item, comparisons drawn from such sources routinely blend measurements taken from two molecules with substantially different behavior.
Four amino acid substitutions separate the modified backbone from the parent GRF(1-29) sequence. These changes reduce recognition by dipeptidyl peptidase IV and related proteases, extending the interval before degradation. Development work in this area sought longer-acting GHRH analogs for endocrine investigation. Published descriptions treat the substitution set as a defining property of the core sequence, while the albumin-binding linker is described separately as an optional addition to that same backbone.
CJC-1295 is a synthetic peptide analog of growth hormone-releasing hormone, constructed on the 29-amino-acid fragment designated GRF(1-29). The name began as an internal development code during the 1990s and later spread through research supply catalogs and discussion forums. The molecule does not occur in nature; its sequence is engineered rather than isolated from tissue. Two related compounds are sold under this single label, and they differ by one appended chemical group that strongly influences how long the peptide remains in circulation.
Naming in this area is inconsistent, and readers should treat product labels with care. In much of the literature and in vendor catalogs, the unqualified term refers to the albumin-binding version, while the version lacking the DAC group appears as modified GRF(1-29), mod GRF(1-29), or the same name with a without-DAC qualifier. Because one abbreviation has been applied to both materials, the only reliable way to identify a sample is to check the stated sequence and the presence of the linker.
CJC-1295 is the name used for a synthetic peptide modeled on growth hormone-releasing hormone, the hypothalamic signal that prompts the pituitary to release growth hormone. The compound was described by a Canadian drug discovery company in the mid-2000s as a long-acting research tool. Two closely related molecules share the name in practice: one carries a drug affinity complex, or DAC, group, and one does not. The distinction matters because the two behave differently in circulation.
The FCC logo or the FCC mark is a voluntary mark employed on electronic products manufactured or sold in the United States which indicates that the electromagnetic radiation from the device is below the limits specified by the Federal Communications Commission and the manufacturer has followed the requirements of the Supplier's Declaration of Conformity authorization procedures. The FCC label is found even on products sold outside the US territory, because they are either products manufactured in the US and had been exported, or they are also sold in the US. This makes the FCC label recognizable worldwide even to people to whom the name of the agency is not familiar. Formerly, devices classified under part 15 or part 18 of the FCC regulations were required to be labelled with the FCC mark, but in November 2017 the mark was made optional. Devices must still be accompanied by a Supplier's Declaration of Conformity (FCC Declaration of Conformity). The responsible party for the Supplier's Declaration of Conformity must be located within the United States.
Mode I – Opening mode (a tensile stress normal to the plane of the crack), Mode II – Sliding mode (a shear stress acting parallel to the plane of the crack and perpendicular to the crack front), and Mode III – Tearing mode (a shear stress acting parallel to the plane of the crack and parallel to the crack front). When the size of the plastic zone at the crack tip is too large, elastic-plastic fracture mechanics can be used with parameters such as the J-integral or the crack tip opening displacement. The characterising parameter describes the state of the crack tip which can then be related to experimental conditions to ensure similitude. Crack growth occurs when the parameters typically exceed certain critical values. Corrosion may cause a crack to slowly grow when the stress corrosion stress intensity threshold is exceeded. Similarly, small flaws may result in crack growth when subjected to cyclic loading. Known as fatigue, it was found that for long cracks, the rate of growth is largely governed by the range of the stress intensity
=== Immune system === Inflammation has been suggested to have a role in the pathogenesis of fibromyalgia. People with fibromyalgia tend to have higher levels of inflammatory cytokines IL-6, and IL-8. There are also increased levels of the pro-inflammatory cytokines IL-1 receptor antagonist. Increased levels of pro-inflammatory cytokines may increase sensitivity to pain, and contribute to mood problems. Anti-inflammatory interleukins such as IL-10 have also been associated with fibromyalgia. Neurogenic inflammation has been proposed as a contributing factor to fibromyalgia. A repeated observation shows that autoimmunity triggers, such as traumas and infections, are among the most frequent events preceding the onset of fibromyalgia. A 2024 discussion concluded that the complexity of FM may mean both autoimmune and non-autoimmune mechanisms occur in FM, possibly in different subgroups of FM.
== Production == Guanidine can be obtained from natural sources, being first isolated in 1861 by Adolph Strecker via the oxidative degradation of an aromatic natural product, guanine, isolated from Peruvian guano. A laboratory method of producing guanidine is gentle (180-190 °C) thermal decomposition of dry ammonium thiocyanate in anhydrous conditions:
In 2019, the Parliament of Togo approved a new bill that allowed Gnassingbé to stay in office until 2030. Despite that, many protests took place in the streets calling for the end of the dynasty after ruling at the time for 52 years.
Sources: en.wikipedia.org
Rock wool (mineral wool) is the most widely used medium in hydroponics. Rock wool is an inert substrate suitable for both run-to-waste and recirculating systems. Rock wool is made from molten rock, basalt or 'slag' that is spun into bundles of single filament fibres, and bonded into a medium capable of capillary action, and is, in effect, protected from most common microbiological degradation. Rock wool is typically used only for the seedling stage, or with newly cut clones, but can remain with the plant base for its lifetime. Rock wool has many advantages and some disadvantages. The latter being the possible skin irritancy (mechanical) whilst handling (1:1000). Flushing with cold water usually brings relief. Advantages include its proven efficiency and effectiveness as a commercial hydroponic substrate. Most of the rock wool sold to date is a non-hazardous, non-carcinogenic material, falling under Note Q of the European Union Classification Packaging and Labeling Regulation (CLP). Mineral wool products can be engineered to hold large quantities of water and air that aid root growth and nutrient uptake in hydroponics; their fibrous nature also provides a good mechanical structure to hold the plant stable. The naturally high pH of mineral wool makes them initially unsuitable to plant growth and requires "conditioning" to produce a wool with an appropriate, stable pH.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
Acral persistent papular mucinosis Atypical lichen myxedematosus (intermediate lichen myxedematosus) Atypical tuberous myxedema (Jadassohn–Dosseker syndrome) Cutaneous focal mucinosis Cutaneous lupus mucinosis (papular and nodular mucinosis in lupus erythematosus, papular and nodular mucinosis of Gold, papulonodular mucinosis in lupus erythematosus) Discrete papular lichen myxedematosus Eccrine mucinosis Follicular mucinosis (alopecia mucinosa, mucinosis follicularis, Pinkus' follicular mucinosis, Pinkus' follicular mucinosis–benign primary form) Localized lichen myxedematosus Myxoid cyst (digital mucous cyst, mucous cyst) Myxoid lipoblastoma Neuropathia mucinosa cutanea Nodular lichen myxedematosus Papular mucinosis (generalized lichen myxedematosus, sclerodermoid lichen myxedematosus, scleromyxedema) Papular mucinosis of infancy (cutaneous mucinosis of infancy) Perifollicular mucinosis Reticular erythematous mucinosis (midline mucinosis, plaque-like cutaneous mucinosis, REM syndrome) Scleroderma Self-healing juvenile cutaneous mucinosis Self-healing papular mucinosis Stiff skin syndrome (congenital fascial dystrophy)
Ancient Chinese legend holds that a man named Lao Ai had the largest penis in history and that he had an affair with Queen Dowager Zhao (c. 280–228 BC), the mother of Qin Shi Huang, by pretending to be a eunuch. Ancient Koreans admired large penises and King Jijeung (437–514 AD) of the Silla Dynasty is said to have had a forty-five-centimeter penis that was so large his subordinates had to search for a woman that fit him. Traditional Japanese erotic paintings usually show genitals as exaggeratedly large. The oldest known painting of this type, found in the Hōryū-ji Temple in Ikaruga, dates to the eighth century AD and depicts a fairly large penis.
The following is a list of women who have been elected or appointed head of state or government of their respective countries. The first list includes female presidents who are heads of state and may also be heads of government, as well as female heads of government who are not concurrently head of state, such as prime ministers. The list does not include Queens regnant who are heads of state (but not of government). Khertek Anchimaa, of the mostly unrecognized and now defunct Tuvan People's Republic, is regarded as the first elected female head of state in the world, although not in multiparty, free and fair elections. The wife of the nation's Supreme Leader, she is the first woman to be elected chairman of a country. She became the chairwoman of the country's presidium in 1940. The first woman to be elected as prime minister of a country was Sirimavo Bandaranaike of Ceylon (present-day Sri Lanka), when she led her party to victory in the July 1960 general election. The first woman to serve as president of a country was Isabel Perón of Argentina, who served as the country's vice president and succeeded to the presidency in July 1974 upon the death of her husband. In 1979, Margaret Thatcher was elected as Prime Minister of the United Kingdom, becoming both the United Kingdom's first female prime minister, and Europe's first elected female head of government.
Sources: en.wikipedia.org
The mass difference from the linker is large enough for routine detection by mass spectrometry. The unconjugated form gives a single sharp signal at its expected weight. Material that has already reacted with albumin shows a much higher mass and a broadened chromatographic peak.
Yes. Degradation proceeds faster once the powder is dissolved, especially at room temperature or after multiple freeze and thaw cycles. Working solutions are often aliquoted to avoid repeated handling. Lyophilized powder held cold and dry retains its properties far longer.
Truncated sequences, oxidized residues and aggregated forms can all elute near the main peak. Reversed phase chromatography resolves many of these species, so the number of peaks is a useful indicator of synthesis quality. A single peak does not by itself prove correct sequence, which is why mass confirmation is paired with it.
Mass spectrometry establishes whether the observed molecular weight matches the calculated sequence mass. Chromatographic retention and fragment mapping add further confidence about sequence and composition. A single technique alone is rarely treated as sufficient evidence of identity.